PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016491457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 166aa    MW: 18177 Da    PI: 7.2602
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016491457.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.36.6e-3276130257
     ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                     +++rY+eClkNhAas+Gg+++DGCgEfmp  geegt +alkCaAC+CHRnFHR+e+
  XP_016491457.1  76 SRARYRECLKNHAASIGGNVTDGCGEFMPC-GEEGTLEALKCAACNCHRNFHRKEQ 130
                     5789*************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.4E-2978130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.2E-3079129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-2179129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.39980129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MALAGEDKEM RMQGSLGYHS LDQNLDQGNH HHHHHHQPNN NNLQPQQDHE KSSSGAAPVV  60
PYSSGGSTNN KFKITSRARY RECLKNHAAS IGGNVTDGCG EFMPCGEEGT LEALKCAACN  120
CHRNFHRKEQ PNVGADNNNN AGIMVVHPLQ LSQPLPSPLP SMNHHH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016491457.11e-121PREDICTED: zinc-finger homeodomain protein 3-like
TrEMBLM0ZWJ49e-55M0ZWJ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000095813e-54(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.15e-30homeobox protein 33